SCOPe 2.06: Domain d2e2hi1: 2e2h I:2-49

Lineage for d2e2hi1 (2e2h I:2-49)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (5 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
   Uniprot P27999; part of multichain biological unit

8. Domain d2e2hi1: 2e2h I:2-49 [131989]
   Other proteins in same PDB: d2e2ha1, d2e2hb1, d2e2hc1, d2e2hc2, d2e2he1, d2e2he2, d2e2hf1, d2e2hh1, d2e2hj1, d2e2hk1, d2e2hl1
   automatically matched to d1i3qi1
   protein/DNA complex; protein/RNA complex; complexed with gtp, mg, zn

Details for d2e2hi1

PDB Entry: 2e2h, 3.95 Å

PDB Description: RNA polymerase II elongation complex at 5 mM Mg2+ with GTP

PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOPe Domain Sequences for d2e2hi1:

Sequence; same for both SEQRES and ATOM records:

>d2e2hi1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

Timeline for d2e2hi1:

• d2e2hi1 first appeared in SCOP 1.73
  
• d2e2hi1 appears in SCOPe 2.05
  
• d2e2hi1 appears in SCOPe 2.07
  
• d2e2hi1 appears in the current release, SCOPe 2.08