SCOP 1.75: Domain d2e2hf1: 2e2h F:72-154

Lineage for d2e2hf1 (2e2h F:72-154)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.2: RPB6 [55294] (1 protein)

6. Protein RPB6 [55295] (2 species)
   essential subunit of RNA polymerases I, II and III

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (29 PDB entries)
   Uniprot P20435; part of multichain biological unit

8. Domain d2e2hf1: 2e2h F:72-154 [131987]
   Other proteins in same PDB: d2e2ha1, d2e2hb1, d2e2hc1, d2e2hc2, d2e2he1, d2e2he2, d2e2hh1, d2e2hi1, d2e2hi2, d2e2hj1, d2e2hk1, d2e2hl1
   automatically matched to d1i3qf_
   complexed with gtp, mg, zn

Details for d2e2hf1

PDB Entry: 2e2h, 3.95 Å

PDB Description: RNA polymerase II elongation complex at 5 mM Mg2+ with GTP

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOP Domain Sequences for d2e2hf1:

Sequence; same for both SEQRES and ATOM records:

>d2e2hf1 a.143.1.2 (F:72-154) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivd

Timeline for d2e2hf1:

• d2e2hf1 first appeared in SCOP 1.73
  
• d2e2hf1 appears in SCOPe 2.01
  
• d2e2hf1 appears in the current release, SCOPe 2.08