Lineage for d2e2he2 (2e2h E:144-215)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913988Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 1913989Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 1913990Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 1913991Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)
  7. 1913992Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (26 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 1914018Domain d2e2he2: 2e2h E:144-215 [131986]
    Other proteins in same PDB: d2e2ha1, d2e2hb1, d2e2hc1, d2e2hc2, d2e2he1, d2e2hf1, d2e2hh1, d2e2hi1, d2e2hi2, d2e2hj1, d2e2hk1, d2e2hl1
    automatically matched to d1dzfa2
    protein/DNA complex; protein/RNA complex; complexed with gtp, mg, zn

Details for d2e2he2

PDB Entry: 2e2h (more details), 3.95 Å

PDB Description: RNA polymerase II elongation complex at 5 mM Mg2+ with GTP
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2e2he2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2he2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d2e2he2:

Click to download the PDB-style file with coordinates for d2e2he2.
(The format of our PDB-style files is described here.)

Timeline for d2e2he2: