Lineage for d2e2he1 (2e2h E:3-143)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700831Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 701191Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 701192Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)
  6. 701193Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)
  7. 701194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries)
  8. 701219Domain d2e2he1: 2e2h E:3-143 [131985]
    Other proteins in same PDB: d2e2ha1, d2e2hb1, d2e2hc1, d2e2hc2, d2e2he2, d2e2hf1, d2e2hh1, d2e2hi1, d2e2hi2, d2e2hj1, d2e2hk1, d2e2hl1
    automatically matched to d1i3qe1
    complexed with gtp, mg, zn

Details for d2e2he1

PDB Entry: 2e2h (more details), 3.95 Å

PDB Description: RNA polymerase II elongation complex at 5 mM Mg2+ with GTP
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOP Domain Sequences for d2e2he1:

Sequence, based on SEQRES records: (download)

>d2e2he1 c.52.3.1 (E:3-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqa
npteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamk
lvpsippatietfneaalvvn

Sequence, based on observed residues (ATOM records): (download)

>d2e2he1 c.52.3.1 (E:3-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdrpqrkmmsfqanpt
eesiskfpdmgslwveftfvihiqeknfqtgifvtpsamklvpsippatietfneaalvv
n

SCOP Domain Coordinates for d2e2he1:

Click to download the PDB-style file with coordinates for d2e2he1.
(The format of our PDB-style files is described here.)

Timeline for d2e2he1: