SCOPe 2.05: Domain d2e2hc1: 2e2h C:3-37,C:173-268

Lineage for d2e2hc1 (2e2h C:3-37,C:173-268)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RPB3 [64315] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
   Uniprot P16370; part of multichain biological unit

8. Domain d2e2hc1: 2e2h C:3-37,C:173-268 [131983]
   Other proteins in same PDB: d2e2ha1, d2e2hb1, d2e2hc2, d2e2he1, d2e2he2, d2e2hf1, d2e2hh1, d2e2hi1, d2e2hi2, d2e2hj1, d2e2hk1, d2e2hl1
   automatically matched to d1i3qc1
   protein/DNA complex; protein/RNA complex; complexed with gtp, mg, zn

Details for d2e2hc1

PDB Entry: 2e2h, 3.95 Å

PDB Description: RNA polymerase II elongation complex at 5 mM Mg2+ with GTP

PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2e2hc1:

Sequence; same for both SEQRES and ATOM records:

>d2e2hc1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd
sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva
sillaltqmdqd

Timeline for d2e2hc1:

• d2e2hc1 first appeared in SCOP 1.73
  
• d2e2hc1 appears in SCOPe 2.04
  
• d2e2hc1 appears in SCOPe 2.06
  
• d2e2hc1 appears in the current release, SCOPe 2.07