Lineage for d2e2dc1 (2e2d C:1001-1180)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667979Superfamily b.40.3: TIMP-like [50242] (3 families) (S)
  5. 667980Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
    contains an irregular alpha+beta subdomain in the C-terminal extension
  6. 667990Protein TIMP-2 [50246] (2 species)
  7. 667991Species Cow (Bos taurus) [TaxId:9913] [50248] (3 PDB entries)
  8. 667992Domain d2e2dc1: 2e2d C:1001-1180 [131980]
    Other proteins in same PDB: d2e2da1
    automatically matched to d1bqqt_
    complexed with ca, zn

Details for d2e2dc1

PDB Entry: 2e2d (more details), 2 Å

PDB Description: Flexibility and variability of TIMP binding: X-ray structure of the complex between collagenase-3/MMP-13 and TIMP-2
PDB Compounds: (C:) metalloproteinase inhibitor 2

SCOP Domain Sequences for d2e2dc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2dc1 b.40.3.1 (C:1001-1180) TIMP-2 {Cow (Bos taurus) [TaxId: 9913]}
cscspvhpqqafcnadivirakavnkkevdsgndiygnpikriqyeikqikmfkgpdqdi
efiytapaaavcgvsldiggkkeyliagkaegngnmhitlcdfivpwdtlsatqkkslnh
ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg

SCOP Domain Coordinates for d2e2dc1:

Click to download the PDB-style file with coordinates for d2e2dc1.
(The format of our PDB-style files is described here.)

Timeline for d2e2dc1:

Domains from other chains:
(mouse over for more information)
d2e2da1