SCOPe 2.08: Domain d2e2dc2: 2e2d C:1002-1180

Lineage for d2e2dc2 (2e2d C:1002-1180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.3: TIMP-like [50242] (4 families)

5. Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
   contains an irregular alpha+beta subdomain in the C-terminal extension
   automatically mapped to Pfam PF00965

6. Protein TIMP-2 [50246] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50248] (3 PDB entries)

8. Domain d2e2dc2: 2e2d C:1002-1180 [131980]
   Other proteins in same PDB: d2e2da_, d2e2dc3
   automated match to d1bqqt_
   complexed with ca, zn

Details for d2e2dc2

PDB Entry: 2e2d, 2 Å

PDB Description: Flexibility and variability of TIMP binding: X-ray structure of the complex between collagenase-3/MMP-13 and TIMP-2

PDB Compounds: (C:) metalloproteinase inhibitor 2

SCOPe Domain Sequences for d2e2dc2:

Sequence; same for both SEQRES and ATOM records:

>d2e2dc2 b.40.3.1 (C:1002-1180) TIMP-2 {Cow (Bos taurus) [TaxId: 9913]}
scspvhpqqafcnadivirakavnkkevdsgndiygnpikriqyeikqikmfkgpdqdie
fiytapaaavcgvsldiggkkeyliagkaegngnmhitlcdfivpwdtlsatqkkslnhr
yqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg

Timeline for d2e2dc2:

• d2e2dc2 first appeared in SCOP 1.73, called d2e2dc1
  
• d2e2dc2 appears in SCOPe 2.07