Lineage for d2e24a3 (2e24 A:387-659)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391750Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2391751Protein automated matches [226849] (8 species)
    not a true protein
  7. 2391752Species Bacillus sp. [TaxId:84635] [254959] (5 PDB entries)
  8. 2391755Domain d2e24a3: 2e24 A:387-659 [131978]
    Other proteins in same PDB: d2e24a1, d2e24a2
    automated match to d2e22a3
    complexed with peg; mutant

Details for d2e24a3

PDB Entry: 2e24 (more details), 2.15 Å

PDB Description: crystal structure of a mutant (r612a) of xanthan lyase
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d2e24a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e24a3 b.30.5.0 (A:387-659) automated matches {Bacillus sp. [TaxId: 84635]}
pnlykqyaamdravlqrpgfalglalystrissyesinsengrgwytgagatylynqdla
qysedywptvdayripgttvasgtpiasgtgtsswtggvslagqygasgmdlsygaynls
arkswfmfddeivalgsgisstagipietvvdnrklngagdnawtangaalstglgvaqt
ltgvnwvhlagntadgsdigyyfpggatlqtkreartgtwkqinnapatpstavtrnyet
mwidhgtnpsgasygyvllpnktsaqvgayaad

SCOPe Domain Coordinates for d2e24a3:

Click to download the PDB-style file with coordinates for d2e24a3.
(The format of our PDB-style files is described here.)

Timeline for d2e24a3: