SCOPe 2.06: Domain d2e24a3: 2e24 A:387-659

Lineage for d2e24a3 (2e24 A:387-659)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.0: automated matches [227145] (1 protein)
   not a true family

6. Protein automated matches [226849] (7 species)
   not a true protein

7. Species Bacillus sp. [TaxId:84635] [254959] (5 PDB entries)

8. Domain d2e24a3: 2e24 A:387-659 [131978]
   Other proteins in same PDB: d2e24a1, d2e24a2
   automated match to d2e22a3
   complexed with peg; mutant

Details for d2e24a3

PDB Entry: 2e24, 2.15 Å

PDB Description: crystal structure of a mutant (r612a) of xanthan lyase

PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d2e24a3:

Sequence; same for both SEQRES and ATOM records:

>d2e24a3 b.30.5.0 (A:387-659) automated matches {Bacillus sp. [TaxId: 84635]}
pnlykqyaamdravlqrpgfalglalystrissyesinsengrgwytgagatylynqdla
qysedywptvdayripgttvasgtpiasgtgtsswtggvslagqygasgmdlsygaynls
arkswfmfddeivalgsgisstagipietvvdnrklngagdnawtangaalstglgvaqt
ltgvnwvhlagntadgsdigyyfpggatlqtkreartgtwkqinnapatpstavtrnyet
mwidhgtnpsgasygyvllpnktsaqvgayaad

Timeline for d2e24a3:

• d2e24a3 first appeared in SCOP 1.73
  
• d2e24a3 appears in SCOPe 2.05
  
• d2e24a3 appears in SCOPe 2.07
  
• d2e24a3 appears in the current release, SCOPe 2.08