Lineage for d2e24a2 (2e24 A:660-777)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777794Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 2777795Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families) (S)
  5. 2777843Family b.24.1.0: automated matches [254204] (1 protein)
    not a true family
  6. 2777844Protein automated matches [254449] (1 species)
    not a true protein
  7. 2777845Species Bacillus sp. [TaxId:84635] [254960] (5 PDB entries)
  8. 2777848Domain d2e24a2: 2e24 A:660-777 [131977]
    Other proteins in same PDB: d2e24a1, d2e24a3
    automated match to d2e24a2
    complexed with peg; mutant

Details for d2e24a2

PDB Entry: 2e24 (more details), 2.15 Å

PDB Description: crystal structure of a mutant (r612a) of xanthan lyase
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d2e24a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e24a2 b.24.1.0 (A:660-777) automated matches {Bacillus sp. [TaxId: 84635]}
paieivvntsgvqsvkektlglvganfwtdttqtadlitsnkkasvmtreiaderleasv
sdptqanngtiaielarsaegysadpgitvtqlaptikftvnvngakgksfhasfqlg

SCOPe Domain Coordinates for d2e24a2:

Click to download the PDB-style file with coordinates for d2e24a2.
(The format of our PDB-style files is described here.)

Timeline for d2e24a2: