Lineage for d2e24a1 (2e24 A:26-386)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276931Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 1276943Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (4 proteins)
  6. 1276986Protein Xanthan lyase [89111] (1 species)
  7. 1276987Species Bacillus sp. GL1 [TaxId:84635] [89112] (7 PDB entries)
  8. 1276990Domain d2e24a1: 2e24 A:26-386 [131976]
    Other proteins in same PDB: d2e24a2, d2e24a3
    automatically matched to d1j0ma1
    complexed with peg; mutant

Details for d2e24a1

PDB Entry: 2e24 (more details), 2.15 Å

PDB Description: crystal structure of a mutant (r612a) of xanthan lyase
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d2e24a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e24a1 a.102.3.2 (A:26-386) Xanthan lyase {Bacillus sp. GL1 [TaxId: 84635]}
sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr
gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay
nwwhwqlgipmslndiavllyddisaarmatymdtidyftpsigltganrawqaivvgvr
avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan
lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi
vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa
a

SCOPe Domain Coordinates for d2e24a1:

Click to download the PDB-style file with coordinates for d2e24a1.
(The format of our PDB-style files is described here.)

Timeline for d2e24a1: