SCOP 1.75: Domain d2e24a1: 2e24 A:26-386

Lineage for d2e24a1 (2e24 A:26-386)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families)
   incomplete toroid

5. Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (4 proteins)

6. Protein Xanthan lyase [89111] (1 species)

7. Species Bacillus sp. gl1 [TaxId:84635] [89112] (7 PDB entries)

8. Domain d2e24a1: 2e24 A:26-386 [131976]
   Other proteins in same PDB: d2e24a2, d2e24a3
   automatically matched to d1j0ma1
   complexed with peg; mutant

Details for d2e24a1

PDB Entry: 2e24, 2.15 Å

PDB Description: crystal structure of a mutant (r612a) of xanthan lyase

PDB Compounds: (A:) xanthan lyase

SCOP Domain Sequences for d2e24a1:

Sequence; same for both SEQRES and ATOM records:

>d2e24a1 a.102.3.2 (A:26-386) Xanthan lyase {Bacillus sp. gl1 [TaxId: 84635]}
sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr
gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay
nwwhwqlgipmslndiavllyddisaarmatymdtidyftpsigltganrawqaivvgvr
avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan
lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi
vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa
a

Timeline for d2e24a1:

• d2e24a1 first appeared in SCOP 1.73
  
• d2e24a1 appears in SCOPe 2.01
  
• d2e24a1 appears in the current release, SCOPe 2.08