Lineage for d2e24a1 (2e24 A:26-386)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722434Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 2722452Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (5 proteins)
  6. 2722499Protein automated matches [254448] (1 species)
    not a true protein
  7. 2722500Species Bacillus sp. [TaxId:84635] [254958] (5 PDB entries)
  8. 2722503Domain d2e24a1: 2e24 A:26-386 [131976]
    Other proteins in same PDB: d2e24a2, d2e24a3
    automated match to d1j0ma1
    complexed with peg; mutant

Details for d2e24a1

PDB Entry: 2e24 (more details), 2.15 Å

PDB Description: crystal structure of a mutant (r612a) of xanthan lyase
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d2e24a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e24a1 a.102.3.2 (A:26-386) automated matches {Bacillus sp. [TaxId: 84635]}
sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr
gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay
nwwhwqlgipmslndiavllyddisaarmatymdtidyftpsigltganrawqaivvgvr
avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan
lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi
vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa
a

SCOPe Domain Coordinates for d2e24a1:

Click to download the PDB-style file with coordinates for d2e24a1.
(The format of our PDB-style files is described here.)

Timeline for d2e24a1: