Lineage for d2e22a3 (2e22 A:387-659)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2052444Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2052583Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2053055Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2053056Protein automated matches [226849] (7 species)
    not a true protein
  7. 2053057Species Bacillus sp. [TaxId:84635] [254959] (5 PDB entries)
  8. 2053061Domain d2e22a3: 2e22 A:387-659 [131975]
    Other proteins in same PDB: d2e22a1, d2e22a2
    automated match to d2e22a3
    complexed with man

Details for d2e22a3

PDB Entry: 2e22 (more details), 2.4 Å

PDB Description: crystal structure of xanthan lyase in complex with mannose
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d2e22a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e22a3 b.30.5.0 (A:387-659) automated matches {Bacillus sp. [TaxId: 84635]}
pnlykqyaamdravlqrpgfalglalystrissyesinsengrgwytgagatylynqdla
qysedywptvdayripgttvasgtpiasgtgtsswtggvslagqygasgmdlsygaynls
arkswfmfddeivalgsgisstagipietvvdnrklngagdnawtangaalstglgvaqt
ltgvnwvhlagntadgsdigyyfpggatlqtkreartgtwkqinnrpatpstavtrnyet
mwidhgtnpsgasygyvllpnktsaqvgayaad

SCOPe Domain Coordinates for d2e22a3:

Click to download the PDB-style file with coordinates for d2e22a3.
(The format of our PDB-style files is described here.)

Timeline for d2e22a3: