Class b: All beta proteins [48724] (176 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
Protein automated matches [226849] (5 species) not a true protein |
Species Bacillus sp. [TaxId:84635] [254959] (5 PDB entries) |
Domain d2e22a3: 2e22 A:387-659 [131975] Other proteins in same PDB: d2e22a1, d2e22a2 automated match to d2e22a3 complexed with man |
PDB Entry: 2e22 (more details), 2.4 Å
SCOPe Domain Sequences for d2e22a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e22a3 b.30.5.0 (A:387-659) automated matches {Bacillus sp. [TaxId: 84635]} pnlykqyaamdravlqrpgfalglalystrissyesinsengrgwytgagatylynqdla qysedywptvdayripgttvasgtpiasgtgtsswtggvslagqygasgmdlsygaynls arkswfmfddeivalgsgisstagipietvvdnrklngagdnawtangaalstglgvaqt ltgvnwvhlagntadgsdigyyfpggatlqtkreartgtwkqinnrpatpstavtrnyet mwidhgtnpsgasygyvllpnktsaqvgayaad
Timeline for d2e22a3: