Lineage for d2e22a2 (2e22 A:660-777)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387466Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 2387467Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families) (S)
  5. 2387515Family b.24.1.0: automated matches [254204] (1 protein)
    not a true family
  6. 2387516Protein automated matches [254449] (1 species)
    not a true protein
  7. 2387517Species Bacillus sp. [TaxId:84635] [254960] (5 PDB entries)
  8. 2387521Domain d2e22a2: 2e22 A:660-777 [131974]
    Other proteins in same PDB: d2e22a1, d2e22a3
    automated match to d2e22a2
    complexed with man

Details for d2e22a2

PDB Entry: 2e22 (more details), 2.4 Å

PDB Description: crystal structure of xanthan lyase in complex with mannose
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d2e22a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e22a2 b.24.1.0 (A:660-777) automated matches {Bacillus sp. [TaxId: 84635]}
paieivvntsgvqsvkektlglvganfwtdttqtadlitsnkkasvmtreiaderleasv
sdptqanngtiaielarsaegysadpgitvtqlaptikftvnvngakgksfhasfqlg

SCOPe Domain Coordinates for d2e22a2:

Click to download the PDB-style file with coordinates for d2e22a2.
(The format of our PDB-style files is described here.)

Timeline for d2e22a2: