![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) ![]() incomplete toroid |
![]() | Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (5 proteins) |
![]() | Protein automated matches [254448] (1 species) not a true protein |
![]() | Species Bacillus sp. [TaxId:84635] [254958] (5 PDB entries) |
![]() | Domain d2e22a1: 2e22 A:26-386 [131973] Other proteins in same PDB: d2e22a2, d2e22a3 automated match to d1j0ma1 complexed with man |
PDB Entry: 2e22 (more details), 2.4 Å
SCOPe Domain Sequences for d2e22a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e22a1 a.102.3.2 (A:26-386) automated matches {Bacillus sp. [TaxId: 84635]} sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay nwwhwqlgipmslndiavllyddisaarmatymdtidyftpsigltganrawqaivvgvr avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa a
Timeline for d2e22a1: