Lineage for d2e22a1 (2e22 A:26-386)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335526Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 2335544Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (5 proteins)
  6. 2335591Protein automated matches [254448] (1 species)
    not a true protein
  7. 2335592Species Bacillus sp. [TaxId:84635] [254958] (5 PDB entries)
  8. 2335596Domain d2e22a1: 2e22 A:26-386 [131973]
    Other proteins in same PDB: d2e22a2, d2e22a3
    automated match to d1j0ma1
    complexed with man

Details for d2e22a1

PDB Entry: 2e22 (more details), 2.4 Å

PDB Description: crystal structure of xanthan lyase in complex with mannose
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d2e22a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e22a1 a.102.3.2 (A:26-386) automated matches {Bacillus sp. [TaxId: 84635]}
sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr
gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay
nwwhwqlgipmslndiavllyddisaarmatymdtidyftpsigltganrawqaivvgvr
avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan
lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi
vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa
a

SCOPe Domain Coordinates for d2e22a1:

Click to download the PDB-style file with coordinates for d2e22a1.
(The format of our PDB-style files is described here.)

Timeline for d2e22a1: