![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins) |
![]() | Protein automated matches [190078] (5 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [186799] (5 PDB entries) |
![]() | Domain d2e1wa_: 2e1w A: [131972] automated match to d1w1ie_ complexed with fr6, zn |
PDB Entry: 2e1w (more details), 2.5 Å
SCOPe Domain Sequences for d2e1wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e1wa_ c.1.9.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr
Timeline for d2e1wa_: