Lineage for d2e1wa_ (2e1w A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833367Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)
  6. 2833415Protein automated matches [190078] (5 species)
    not a true protein
  7. 2833416Species Cow (Bos taurus) [TaxId:9913] [186799] (5 PDB entries)
  8. 2833419Domain d2e1wa_: 2e1w A: [131972]
    automated match to d1w1ie_
    complexed with fr6, zn

Details for d2e1wa_

PDB Entry: 2e1w (more details), 2.5 Å

PDB Description: Crystal structure of adenosine deaminase complexed with potent inhibitors
PDB Compounds: (A:) adenosine deaminase

SCOPe Domain Sequences for d2e1wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e1wa_ c.1.9.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla
kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr

SCOPe Domain Coordinates for d2e1wa_:

Click to download the PDB-style file with coordinates for d2e1wa_.
(The format of our PDB-style files is described here.)

Timeline for d2e1wa_: