SCOP 1.73: Domain d2e1ra5: 2e1r A:726-842

Lineage for d2e1ra5 (2e1r A:726-842)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families)

5. Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
   domain III structure is lacking some of the superfamily characters and is often disordered in crystals

6. Protein Elongation factor 2 (eEF-2) [82677] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries)

8. Domain d2e1ra5: 2e1r A:726-842 [131970]
   Other proteins in same PDB: d2e1ra1, d2e1ra2, d2e1ra3
   automatically matched to d1n0ua5
   complexed with gdp, sod

Details for d2e1ra5

PDB Entry: 2e1r, 3.15 Å

PDB Description: structure of eef2 in complex with a sordarin derivative

PDB Compounds: (A:) Elongation factor 2

SCOP Domain Sequences for d2e1ra5:

Sequence; same for both SEQRES and ATOM records:

>d2e1ra5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

Timeline for d2e1ra5:

• d2e1ra5 is new in SCOP 1.73
  
• d2e1ra5 appears in SCOP 1.75
  
• d2e1ra5 appears in the current release, SCOPe 2.07