![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) ![]() |
![]() | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
![]() | Protein Elongation factor 2 (eEF-2) [82677] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries) |
![]() | Domain d2e1ra5: 2e1r A:726-842 [131970] Other proteins in same PDB: d2e1ra1, d2e1ra2, d2e1ra3 automatically matched to d1n0ua5 complexed with gdp, sod |
PDB Entry: 2e1r (more details), 3.15 Å
SCOP Domain Sequences for d2e1ra5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e1ra5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
Timeline for d2e1ra5:
![]() Domains from same chain: (mouse over for more information) d2e1ra1, d2e1ra2, d2e1ra3, d2e1ra4 |