![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
![]() | Family d.58.11.0: automated matches [254210] (1 protein) not a true family |
![]() | Protein automated matches [254469] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255012] (4 PDB entries) |
![]() | Domain d2e1ra4: 2e1r A:482-560 [131969] Other proteins in same PDB: d2e1ra1, d2e1ra2, d2e1ra3 automated match to d1n0ua4 complexed with gdp, sod |
PDB Entry: 2e1r (more details), 3.15 Å
SCOPe Domain Sequences for d2e1ra4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e1ra4 d.58.11.0 (A:482-560) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic lqdlehdhagvplkisppv
Timeline for d2e1ra4:
![]() Domains from same chain: (mouse over for more information) d2e1ra1, d2e1ra2, d2e1ra3, d2e1ra5 |