![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
![]() | Protein automated matches [190826] (17 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255013] (5 PDB entries) |
![]() | Domain d2e1ra3: 2e1r A:561-725 [131968] Other proteins in same PDB: d2e1ra1, d2e1ra2, d2e1ra4, d2e1ra5 automated match to d1n0ua3 complexed with gdp, sod |
PDB Entry: 2e1r (more details), 3.15 Å
SCOPe Domain Sequences for d2e1ra3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e1ra3 d.14.1.0 (A:561-725) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq
Timeline for d2e1ra3:
![]() Domains from same chain: (mouse over for more information) d2e1ra1, d2e1ra2, d2e1ra4, d2e1ra5 |