Lineage for d2e1oa1 (2e1o A:8-64)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2304502Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2304503Family a.4.1.1: Homeodomain [46690] (41 protein domains)
    Pfam PF00046
  6. 2304577Protein Homeobox protein prh [140149] (1 species)
  7. 2304578Species Human (Homo sapiens) [TaxId:9606] [140150] (1 PDB entry)
    Uniprot Q03014 138-194
  8. 2304579Domain d2e1oa1: 2e1o A:8-64 [131965]
    Other proteins in same PDB: d2e1oa2, d2e1oa3

Details for d2e1oa1

PDB Entry: 2e1o (more details)

PDB Description: Solution structure of RSGI RUH-028, a homeobox domain from human cDNA
PDB Compounds: (A:) Homeobox protein PRH

SCOPe Domain Sequences for d2e1oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]}
kggqvrfsndqtielekkfetqkylspperkrlakmlqlserqvktwfqnrrakwrr

SCOPe Domain Coordinates for d2e1oa1:

Click to download the PDB-style file with coordinates for d2e1oa1.
(The format of our PDB-style files is described here.)

Timeline for d2e1oa1: