Lineage for d2e1fa1 (2e1f A:1142-1235)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 643210Superfamily a.60.8: HRDC-like [47819] (4 families) (S)
  5. 643211Family a.60.8.1: HRDC domain from helicases [47820] (2 proteins)
  6. 643219Protein Werner syndrome ATP-dependent helicase, WRN [140640] (1 species)
  7. 643220Species Human (Homo sapiens) [TaxId:9606] [140641] (3 PDB entries)
  8. 643221Domain d2e1fa1: 2e1f A:1142-1235 [131964]
    automatically matched to 2E1E A:1142-1235
    complexed with cl

Details for d2e1fa1

PDB Entry: 2e1f (more details), 2 Å

PDB Description: Crystal structure of the HRDC Domain of Human Werner Syndrome Protein, WRN
PDB Compounds: (A:) Werner syndrome ATP-dependent helicase

SCOP Domain Sequences for d2e1fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e1fa1 a.60.8.1 (A:1142-1235) Werner syndrome ATP-dependent helicase, WRN {Human (Homo sapiens) [TaxId: 9606]}
qpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrpttvenvkri
dgvsegkaamlapllevikhfcqtnsvqtdlfss

SCOP Domain Coordinates for d2e1fa1:

Click to download the PDB-style file with coordinates for d2e1fa1.
(The format of our PDB-style files is described here.)

Timeline for d2e1fa1: