Class a: All alpha proteins [46456] (258 folds) |
Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.8: HRDC-like [47819] (4 families) |
Family a.60.8.1: HRDC domain from helicases [47820] (2 proteins) |
Protein Werner syndrome ATP-dependent helicase, WRN [140640] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140641] (3 PDB entries) |
Domain d2e1fa1: 2e1f A:1142-1235 [131964] automatically matched to 2E1E A:1142-1235 complexed with cl |
PDB Entry: 2e1f (more details), 2 Å
SCOP Domain Sequences for d2e1fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e1fa1 a.60.8.1 (A:1142-1235) Werner syndrome ATP-dependent helicase, WRN {Human (Homo sapiens) [TaxId: 9606]} qpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrpttvenvkri dgvsegkaamlapllevikhfcqtnsvqtdlfss
Timeline for d2e1fa1: