Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.8: HRDC-like [47819] (5 families) |
Family a.60.8.1: HRDC domain from helicases [47820] (3 proteins) |
Protein automated matches [190428] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187319] (1 PDB entry) |
Domain d2e1fa_: 2e1f A: [131964] automated match to d2dgza1 complexed with cl |
PDB Entry: 2e1f (more details), 2 Å
SCOPe Domain Sequences for d2e1fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e1fa_ a.60.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrpttvenvkri dgvsegkaamlapllevikhfcqtnsvqtdlfss
Timeline for d2e1fa_: