Lineage for d2e1fa_ (2e1f A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716244Superfamily a.60.8: HRDC-like [47819] (5 families) (S)
  5. 2716245Family a.60.8.1: HRDC domain from helicases [47820] (3 proteins)
  6. 2716255Protein automated matches [190428] (2 species)
    not a true protein
  7. 2716259Species Human (Homo sapiens) [TaxId:9606] [187319] (1 PDB entry)
  8. 2716260Domain d2e1fa_: 2e1f A: [131964]
    automated match to d2dgza1
    complexed with cl

Details for d2e1fa_

PDB Entry: 2e1f (more details), 2 Å

PDB Description: Crystal structure of the HRDC Domain of Human Werner Syndrome Protein, WRN
PDB Compounds: (A:) Werner syndrome ATP-dependent helicase

SCOPe Domain Sequences for d2e1fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e1fa_ a.60.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrpttvenvkri
dgvsegkaamlapllevikhfcqtnsvqtdlfss

SCOPe Domain Coordinates for d2e1fa_:

Click to download the PDB-style file with coordinates for d2e1fa_.
(The format of our PDB-style files is described here.)

Timeline for d2e1fa_: