![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.8: HRDC-like [47819] (4 families) ![]() |
![]() | Family a.60.8.1: HRDC domain from helicases [47820] (2 proteins) |
![]() | Protein Werner syndrome ATP-dependent helicase, WRN [140640] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140641] (3 PDB entries) |
![]() | Domain d2e1ea1: 2e1e A:1142-1235 [131963] complexed with cl |
PDB Entry: 2e1e (more details), 2.3 Å
SCOP Domain Sequences for d2e1ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e1ea1 a.60.8.1 (A:1142-1235) Werner syndrome ATP-dependent helicase, WRN {Human (Homo sapiens) [TaxId: 9606]} qpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrpttvenvkri dgvsegkaamlapllevikhfcqtnsvqtdlfss
Timeline for d2e1ea1: