Lineage for d2e0x.2 (2e0x C:29-387,D:391-580)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995850Family d.153.1.6: Gamma-glutamyltranspeptidase-like [143906] (4 proteins)
    Pfam PF01019
  6. 2995854Protein Gamma-glutamyltranspeptidase, GGT [143911] (2 species)
  7. 2995855Species Escherichia coli [TaxId:562] [143913] (7 PDB entries)
    Uniprot P18956 29-387,391-580! Uniprot P18956 29-580
  8. 2995867Domain d2e0x.2: 2e0x C:29-387,D:391-580 [131960]
    mature cleaved protein
    complexed with ca

Details for d2e0x.2

PDB Entry: 2e0x (more details), 1.95 Å

PDB Description: crystal structure of gamma-glutamyltranspeptidase from escherichia coli (monoclinic form)
PDB Compounds: (C:) Gamma-glutamyltranspeptidase, (D:) Gamma-glutamyltranspeptidase

SCOPe Domain Sequences for d2e0x.2:

Sequence, based on SEQRES records: (download)

>g2e0x.2 d.153.1.6 (C:29-387,D:391-580) Gamma-glutamyltranspeptidase, GGT {Escherichia coli [TaxId: 562]}
appvsygveedvfhpvrakqgmvasvdatatqvgvdilkeggnavdaavavgyalavthp
qagnlggggfmlirskngnttaidfremapakatrdmflddqgnpdskksltshlasgtp
gtvagfslaldkygtmplnkvvqpafklardgfivndaladdlktygsevlpnhenskai
fwkegeplkkgdtlvqanlakslemiaengpdefykgtiaeqiaqemqkngglitkedla
aykavertpisgdyrgyqvysmpppssggihivqilnilenfdmkkygfgsadamqimae
aekyayadrseylgdpdfvkvpwqaltnkayaksiadqidinkakpsseirpgklapyeX
tthysvvdkdgnavavtytlnttfgtgivagesgillnnqmddfsakpgvpnvyglvggd
anavgpnkrplssmsptivvkdgktwlvtgspggsriittvlqmvvnsidyglnvaeatn
aprfhhqwlpdelrvekgfspdtlklleakgqkvalkeamgstqsimvgpdgelygasdp
rsvddltagy

Sequence, based on observed residues (ATOM records): (download)

>g2e0x.2 d.153.1.6 (C:29-387,D:391-580) Gamma-glutamyltranspeptidase, GGT {Escherichia coli [TaxId: 562]}
appvsygveedvfhpvrakqgmvasvdatatqvgvdilkeggnavdaavavgyalavthp
qagnlggggfmlirskngnttaidfremapakatrdmflddqgnpdskksltshlasgtp
gtvagfslaldkygtmplnkvvqpafklardgfivndaladdlktygsevlpnhenskai
fwkegeplkkgdtlvqanlakslemiaengpdefykgtiaeqiaqemqkngglitkedla
aykavertpisgdyrgyqvysmpppssggihivqilnilenfdmkkygfgsadamqimae
aekyayadrseylgdpdfvkvpwqaltnkayaksiadqidinkakpsseirpgklapyeX
tthysvvdkdgnavavtytlnttfgtgivagesgillnnqmddfsakpgdanavgpnkrp
lssmsptivvkdgktwlvtgspggsriittvlqmvvnsidyglnvaeatnaprfhhqwlp
delrvekgfspdtlklleakgqkvalkeamgstqsimvgpdgelygasdprsvddltagy

SCOPe Domain Coordinates for d2e0x.2:

Click to download the PDB-style file with coordinates for d2e0x.2.
(The format of our PDB-style files is described here.)

Timeline for d2e0x.2: