Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [225036] (50 PDB entries) |
Domain d2dyxa_: 2dyx A: [131955] automated match to d1iq7a_ complexed with co3, fe, so4, zn |
PDB Entry: 2dyx (more details), 2 Å
SCOPe Domain Sequences for d2dyxa_:
Sequence, based on SEQRES records: (download)
>d2dyxa_ c.94.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacaf
>d2dyxa_ c.94.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf ndnteclaklggrptyeeylgteyvtaianlkkcsleacaf
Timeline for d2dyxa_: