Lineage for d2dysz_ (2dys Z:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1957780Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
    automatically mapped to Pfam PF02285
  5. 1957781Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)
  6. 1957803Protein automated matches [190273] (1 species)
    not a true protein
  7. 1957804Species Cow (Bos taurus) [TaxId:9913] [187065] (18 PDB entries)
  8. 1957831Domain d2dysz_: 2dys Z: [131954]
    Other proteins in same PDB: d2dysa_, d2dysb1, d2dysb2, d2dysc_, d2dysd_, d2dyse_, d2dysf_, d2dysg_, d2dysh_, d2dysi_, d2dysj_, d2dysk_, d2dysl_, d2dysn_, d2dyso1, d2dyso2, d2dysp_, d2dysq_, d2dysr_, d2dyss_, d2dyst_, d2dysu_, d2dysv_, d2dysw_, d2dysx_, d2dysy_
    automated match to d1occm_
    complexed with cdl, chd, cu, cua, dcw, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dysz_

PDB Entry: 2dys (more details), 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD
PDB Compounds: (Z:) Cytochrome c oxidase polypeptide VIII-heart

SCOPe Domain Sequences for d2dysz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dysz_ f.23.7.1 (Z:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOPe Domain Coordinates for d2dysz_:

Click to download the PDB-style file with coordinates for d2dysz_.
(The format of our PDB-style files is described here.)

Timeline for d2dysz_: