Lineage for d2dysr_ (2dys R:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1746427Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
    automatically mapped to Pfam PF02284
  5. 1746428Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 1746429Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 1746430Species Cow (Bos taurus) [TaxId:9913] [48482] (26 PDB entries)
  8. 1746462Domain d2dysr_: 2dys R: [131946]
    Other proteins in same PDB: d2dysa_, d2dysb1, d2dysb2, d2dysc_, d2dysd_, d2dysf_, d2dysg_, d2dysh_, d2dysi_, d2dysj_, d2dysk_, d2dysl_, d2dysm_, d2dysn_, d2dyso1, d2dyso2, d2dysp_, d2dysq_, d2dyss_, d2dyst_, d2dysu_, d2dysv_, d2dysw_, d2dysx_, d2dysy_, d2dysz_
    automated match to d1occe_
    complexed with cdl, chd, cu, cua, dcw, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dysr_

PDB Entry: 2dys (more details), 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD
PDB Compounds: (R:) Cytochrome c oxidase polypeptide Va

SCOPe Domain Sequences for d2dysr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dysr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d2dysr_:

Click to download the PDB-style file with coordinates for d2dysr_.
(The format of our PDB-style files is described here.)

Timeline for d2dysr_: