Lineage for d2dysq_ (2dys Q:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630216Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
    automatically mapped to Pfam PF02936
  5. 2630217Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)
  6. 2630271Protein automated matches [190270] (1 species)
    not a true protein
  7. 2630272Species Cow (Bos taurus) [TaxId:9913] [187062] (25 PDB entries)
  8. 2630301Domain d2dysq_: 2dys Q: [131945]
    Other proteins in same PDB: d2dysa_, d2dysb1, d2dysb2, d2dysc_, d2dyse_, d2dysf_, d2dysg_, d2dysh_, d2dysi_, d2dysj_, d2dysk_, d2dysl_, d2dysm_, d2dysn_, d2dyso1, d2dyso2, d2dysp_, d2dysr_, d2dyss_, d2dyst_, d2dysu_, d2dysv_, d2dysw_, d2dysx_, d2dysy_, d2dysz_
    automated match to d1occd_
    complexed with cdl, chd, cu, cua, dcw, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dysq_

PDB Entry: 2dys (more details), 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD
PDB Compounds: (Q:) Cytochrome c oxidase subunit 4 isoform 1

SCOPe Domain Sequences for d2dysq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dysq_ f.23.1.1 (Q:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOPe Domain Coordinates for d2dysq_:

Click to download the PDB-style file with coordinates for d2dysq_.
(The format of our PDB-style files is described here.)

Timeline for d2dysq_: