| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) ![]() automatically mapped to Pfam PF02046 |
| Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins) |
| Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
| Species Cow (Bos taurus) [TaxId:9913] [81408] (51 PDB entries) |
| Domain d2dysg_: 2dys G: [131934] Other proteins in same PDB: d2dysa_, d2dysb1, d2dysb2, d2dysc_, d2dysd_, d2dyse_, d2dysf_, d2dysh_, d2dysi_, d2dysj_, d2dysk_, d2dysl_, d2dysm_, d2dysn_, d2dyso1, d2dyso2, d2dysp_, d2dysq_, d2dysr_, d2dyss_, d2dysu_, d2dysv_, d2dysw_, d2dysx_, d2dysy_, d2dysz_ automated match to d1occg_ complexed with cdl, chd, cu, cua, dcw, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 2dys (more details), 2.2 Å
SCOPe Domain Sequences for d2dysg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dysg_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek
Timeline for d2dysg_:
View in 3DDomains from other chains: (mouse over for more information) d2dysa_, d2dysb1, d2dysb2, d2dysc_, d2dysd_, d2dyse_, d2dysf_, d2dysh_, d2dysi_, d2dysj_, d2dysk_, d2dysl_, d2dysm_, d2dysn_, d2dyso1, d2dyso2, d2dysp_, d2dysq_, d2dysr_, d2dyss_, d2dyst_, d2dysu_, d2dysv_, d2dysw_, d2dysx_, d2dysy_, d2dysz_ |