Lineage for d2dyrw_ (2dyr W:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025133Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
    automatically mapped to Pfam PF02238
  5. 3025134Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins)
  6. 3025135Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025136Species Cow (Bos taurus) [TaxId:9913] [81416] (56 PDB entries)
  8. 3025142Domain d2dyrw_: 2dyr W: [131923]
    Other proteins in same PDB: d2dyra_, d2dyrb1, d2dyrb2, d2dyrc_, d2dyrd_, d2dyre_, d2dyrf_, d2dyrg_, d2dyrh_, d2dyri_, d2dyrk_, d2dyrl_, d2dyrm_, d2dyrn_, d2dyro1, d2dyro2, d2dyrp_, d2dyrq_, d2dyrr_, d2dyrs_, d2dyrt_, d2dyru_, d2dyrv_, d2dyrx_, d2dyry_, d2dyrz_
    automated match to d1ocrj_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyrw_

PDB Entry: 2dyr (more details), 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state
PDB Compounds: (W:) Cytochrome c oxidase polypeptide VIIa-heart

SCOPe Domain Sequences for d2dyrw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyrw_ f.23.4.1 (W:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

SCOPe Domain Coordinates for d2dyrw_:

Click to download the PDB-style file with coordinates for d2dyrw_.
(The format of our PDB-style files is described here.)

Timeline for d2dyrw_: