Lineage for d2dyrt1 (2dyr T:1-84)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745566Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
  5. 745567Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (1 protein)
  6. 745568Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 745569Species Cow (Bos taurus) [TaxId:9913] [81408] (14 PDB entries)
  8. 745573Domain d2dyrt1: 2dyr T:1-84 [131920]
    Other proteins in same PDB: d2dyra1, d2dyrb1, d2dyrb2, d2dyrc1, d2dyrd1, d2dyre1, d2dyrf1, d2dyrh1, d2dyri1, d2dyrj1, d2dyrk1, d2dyrl1, d2dyrm1, d2dyrn1, d2dyro1, d2dyro2, d2dyrp1, d2dyrq1, d2dyrr1, d2dyrs1, d2dyru1, d2dyrv1, d2dyrw1, d2dyrx1, d2dyry1, d2dyrz1
    automatically matched to d1occg_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyrt1

PDB Entry: 2dyr (more details), 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state
PDB Compounds: (T:) Cytochrome c oxidase polypeptide VIa-heart

SCOP Domain Sequences for d2dyrt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyrt1 f.23.2.1 (T:1-84) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOP Domain Coordinates for d2dyrt1:

Click to download the PDB-style file with coordinates for d2dyrt1.
(The format of our PDB-style files is described here.)

Timeline for d2dyrt1: