Lineage for d2dyrs_ (2dyr S:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263118Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2263283Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 2263284Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 2263285Species Cow (Bos taurus) [TaxId:9913] [57820] (35 PDB entries)
  8. 2263289Domain d2dyrs_: 2dyr S: [131919]
    Other proteins in same PDB: d2dyra_, d2dyrb1, d2dyrb2, d2dyrc_, d2dyrd_, d2dyre_, d2dyrg_, d2dyrh_, d2dyri_, d2dyrj_, d2dyrk_, d2dyrl_, d2dyrm_, d2dyrn_, d2dyro1, d2dyro2, d2dyrp_, d2dyrq_, d2dyrr_, d2dyrt_, d2dyru_, d2dyrv_, d2dyrw_, d2dyrx_, d2dyry_, d2dyrz_
    automated match to d1occf_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyrs_

PDB Entry: 2dyr (more details), 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state
PDB Compounds: (S:) Cytochrome c oxidase polypeptide Vb

SCOPe Domain Sequences for d2dyrs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyrs_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOPe Domain Coordinates for d2dyrs_:

Click to download the PDB-style file with coordinates for d2dyrs_.
(The format of our PDB-style files is described here.)

Timeline for d2dyrs_: