Lineage for d2dyrs1 (2dyr S:1-98)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 750855Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 750979Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
    membrane-anchored rubredoxin-like domain
  6. 750980Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 750981Species Cow (Bos taurus) [TaxId:9913] [57820] (14 PDB entries)
  8. 750985Domain d2dyrs1: 2dyr S:1-98 [131919]
    Other proteins in same PDB: d2dyra1, d2dyrb1, d2dyrb2, d2dyrc1, d2dyrd1, d2dyre1, d2dyrg1, d2dyrh1, d2dyri1, d2dyrj1, d2dyrk1, d2dyrl1, d2dyrm1, d2dyrn1, d2dyro1, d2dyro2, d2dyrp1, d2dyrq1, d2dyrr1, d2dyrt1, d2dyru1, d2dyrv1, d2dyrw1, d2dyrx1, d2dyry1, d2dyrz1
    automatically matched to d1occf_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyrs1

PDB Entry: 2dyr (more details), 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state
PDB Compounds: (S:) Cytochrome c oxidase polypeptide Vb

SCOP Domain Sequences for d2dyrs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyrs1 g.41.5.3 (S:1-98) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOP Domain Coordinates for d2dyrs1:

Click to download the PDB-style file with coordinates for d2dyrs1.
(The format of our PDB-style files is described here.)

Timeline for d2dyrs1: