SCOP 1.75: Domain d2dyrp1: 2dyr P:3-261

Lineage for d2dyrp1 (2dyr P:3-261)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family)

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (14 PDB entries)

8. Domain d2dyrp1: 2dyr P:3-261 [131916]
   Other proteins in same PDB: d2dyra1, d2dyrb1, d2dyrb2, d2dyrd1, d2dyre1, d2dyrf1, d2dyrg1, d2dyrh1, d2dyri1, d2dyrj1, d2dyrk1, d2dyrl1, d2dyrm1, d2dyrn1, d2dyro1, d2dyro2, d2dyrq1, d2dyrr1, d2dyrs1, d2dyrt1, d2dyru1, d2dyrv1, d2dyrw1, d2dyrx1, d2dyry1, d2dyrz1
   automatically matched to d1v54c_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyrp1

PDB Entry: 2dyr, 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state

PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOP Domain Sequences for d2dyrp1:

Sequence; same for both SEQRES and ATOM records:

>d2dyrp1 f.25.1.1 (P:3-261) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

Timeline for d2dyrp1:

• d2dyrp1 first appeared in SCOP 1.73
  
• d2dyrp1 is called d2dyrp_ in SCOPe 2.01
  
• d2dyrp1 appears in the current release, SCOPe 2.08, called d2dyrp_