SCOPe 2.07: Domain d2dyrm_: 2dyr M:

Lineage for d2dyrm_ (2dyr M:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family)
   automatically mapped to Pfam PF02285

5. Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)

6. Protein automated matches [190273] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187065] (25 PDB entries)

8. Domain d2dyrm_: 2dyr M: [131912]
   Other proteins in same PDB: d2dyra_, d2dyrb1, d2dyrb2, d2dyrc_, d2dyrd_, d2dyre_, d2dyrf_, d2dyrg_, d2dyrh_, d2dyri_, d2dyrj_, d2dyrk_, d2dyrl_, d2dyrn_, d2dyro1, d2dyro2, d2dyrp_, d2dyrq_, d2dyrr_, d2dyrs_, d2dyrt_, d2dyru_, d2dyrv_, d2dyrw_, d2dyrx_, d2dyry_
   automated match to d1occm_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyrm_

PDB Entry: 2dyr, 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state

PDB Compounds: (M:) Cytochrome c oxidase polypeptide VIII-heart

SCOPe Domain Sequences for d2dyrm_:

Sequence; same for both SEQRES and ATOM records:

>d2dyrm_ f.23.7.1 (M:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

Timeline for d2dyrm_:

• d2dyrm_ first appeared in SCOP 1.73, called d2dyrm1
  
• d2dyrm_ appears in SCOPe 2.06
  
• d2dyrm_ appears in the current release, SCOPe 2.08