Lineage for d2dyrj1 (2dyr J:1-58)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745630Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
  5. 745631Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (1 protein)
  6. 745632Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 745633Species Cow (Bos taurus) [TaxId:9913] [81416] (14 PDB entries)
  8. 745636Domain d2dyrj1: 2dyr J:1-58 [131909]
    Other proteins in same PDB: d2dyra1, d2dyrb1, d2dyrb2, d2dyrc1, d2dyrd1, d2dyre1, d2dyrf1, d2dyrg1, d2dyrh1, d2dyri1, d2dyrk1, d2dyrl1, d2dyrm1, d2dyrn1, d2dyro1, d2dyro2, d2dyrp1, d2dyrq1, d2dyrr1, d2dyrs1, d2dyrt1, d2dyru1, d2dyrv1, d2dyrx1, d2dyry1, d2dyrz1
    automatically matched to d1ocrj_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyrj1

PDB Entry: 2dyr (more details), 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state
PDB Compounds: (J:) Cytochrome c oxidase polypeptide VIIa-heart

SCOP Domain Sequences for d2dyrj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyrj1 f.23.4.1 (J:1-58) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

SCOP Domain Coordinates for d2dyrj1:

Click to download the PDB-style file with coordinates for d2dyrj1.
(The format of our PDB-style files is described here.)

Timeline for d2dyrj1: