Lineage for d2dyre_ (2dyr E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2011125Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
    automatically mapped to Pfam PF02284
  5. 2011126Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2011127Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2011128Species Cow (Bos taurus) [TaxId:9913] [48482] (35 PDB entries)
  8. 2011131Domain d2dyre_: 2dyr E: [131904]
    Other proteins in same PDB: d2dyra_, d2dyrb1, d2dyrb2, d2dyrc_, d2dyrd_, d2dyrf_, d2dyrg_, d2dyrh_, d2dyri_, d2dyrj_, d2dyrk_, d2dyrl_, d2dyrm_, d2dyrn_, d2dyro1, d2dyro2, d2dyrp_, d2dyrq_, d2dyrs_, d2dyrt_, d2dyru_, d2dyrv_, d2dyrw_, d2dyrx_, d2dyry_, d2dyrz_
    automated match to d1occe_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyre_

PDB Entry: 2dyr (more details), 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state
PDB Compounds: (E:) Cytochrome c oxidase polypeptide Va

SCOPe Domain Sequences for d2dyre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyre_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d2dyre_:

Click to download the PDB-style file with coordinates for d2dyre_.
(The format of our PDB-style files is described here.)

Timeline for d2dyre_: