Lineage for d2dyrc1 (2dyr C:3-261)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746159Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 746160Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
  5. 746161Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 746174Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 746175Species Cow (Bos taurus) [TaxId:9913] [81444] (14 PDB entries)
  8. 746178Domain d2dyrc1: 2dyr C:3-261 [131902]
    Other proteins in same PDB: d2dyra1, d2dyrb1, d2dyrb2, d2dyrd1, d2dyre1, d2dyrf1, d2dyrg1, d2dyrh1, d2dyri1, d2dyrj1, d2dyrk1, d2dyrl1, d2dyrm1, d2dyrn1, d2dyro1, d2dyro2, d2dyrq1, d2dyrr1, d2dyrs1, d2dyrt1, d2dyru1, d2dyrv1, d2dyrw1, d2dyrx1, d2dyry1, d2dyrz1
    automatically matched to d1v54c_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyrc1

PDB Entry: 2dyr (more details), 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state
PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOP Domain Sequences for d2dyrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyrc1 f.25.1.1 (C:3-261) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOP Domain Coordinates for d2dyrc1:

Click to download the PDB-style file with coordinates for d2dyrc1.
(The format of our PDB-style files is described here.)

Timeline for d2dyrc1: