Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) automatically mapped to Pfam PF00510 |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries) |
Domain d2dyrc_: 2dyr C: [131902] Other proteins in same PDB: d2dyra_, d2dyrb1, d2dyrb2, d2dyrd_, d2dyre_, d2dyrf_, d2dyrg_, d2dyrh_, d2dyri_, d2dyrj_, d2dyrk_, d2dyrl_, d2dyrm_, d2dyrn_, d2dyro1, d2dyro2, d2dyrq_, d2dyrr_, d2dyrs_, d2dyrt_, d2dyru_, d2dyrv_, d2dyrw_, d2dyrx_, d2dyry_, d2dyrz_ automated match to d1occc_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 2dyr (more details), 1.8 Å
SCOPe Domain Sequences for d2dyrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dyrc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d2dyrc_:
View in 3D Domains from other chains: (mouse over for more information) d2dyra_, d2dyrb1, d2dyrb2, d2dyrd_, d2dyre_, d2dyrf_, d2dyrg_, d2dyrh_, d2dyri_, d2dyrj_, d2dyrk_, d2dyrl_, d2dyrm_, d2dyrn_, d2dyro1, d2dyro2, d2dyrp_, d2dyrq_, d2dyrr_, d2dyrs_, d2dyrt_, d2dyru_, d2dyrv_, d2dyrw_, d2dyrx_, d2dyry_, d2dyrz_ |