SCOP 1.73: Domain d2dyrb2: 2dyr B:1-90

Lineage for d2dyrb2 (2dyr B:1-90)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (3 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries)

8. Domain d2dyrb2: 2dyr B:1-90 [131901]
   Other proteins in same PDB: d2dyra1, d2dyrb1, d2dyrc1, d2dyrd1, d2dyre1, d2dyrf1, d2dyrg1, d2dyrh1, d2dyri1, d2dyrj1, d2dyrk1, d2dyrl1, d2dyrm1, d2dyrn1, d2dyro1, d2dyrp1, d2dyrq1, d2dyrr1, d2dyrs1, d2dyrt1, d2dyru1, d2dyrv1, d2dyrw1, d2dyrx1, d2dyry1, d2dyrz1
   automatically matched to d1occb2
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyrb2

PDB Entry: 2dyr, 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2dyrb2:

Sequence; same for both SEQRES and ATOM records:

>d2dyrb2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d2dyrb2:

• d2dyrb2 is new in SCOP 1.73
  
• d2dyrb2 appears in SCOP 1.75
  
• d2dyrb2 appears in the current release, SCOPe 2.08