Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
Species Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries) Uniprot O58429 3-155 |
Domain d2dyab_: 2dya B: [131896] automated match to d2cwka1 complexed with adp, cl, mg |
PDB Entry: 2dya (more details), 1.77 Å
SCOPe Domain Sequences for d2dyab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dyab_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Pyrococcus horikoshii [TaxId: 53953]} setertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpff kalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnvih asdskesaereislffkpeelfeypraadwfykkg
Timeline for d2dyab_: