SCOPe 2.08: Domain d2dyaa_: 2dya A:

Lineage for d2dyaa_ (2dya A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
   Uniprot O58429 3-155

8. Domain d2dyaa_: 2dya A: [131895]
   automated match to d2cwka1
   complexed with adp, cl, mg

Details for d2dyaa_

PDB Entry: 2dya, 1.77 Å

PDB Description: Crystal structure of complex between Adenine nucleotide and nucleoside diphosphate kinase

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2dyaa_:

Sequence; same for both SEQRES and ATOM records:

>d2dyaa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pyrococcus horikoshii [TaxId: 53953]}
setertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpff
kalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnvih
asdskesaereislffkpeelfeypraadwfykk

Timeline for d2dyaa_:

• d2dyaa_ first appeared in SCOP 1.73, called d2dyaa1
  
• d2dyaa_ appears in SCOPe 2.07