SCOPe 2.05: Domain d2dy9a_: 2dy9 A:

Lineage for d2dy9a_ (2dy9 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
   Uniprot O58429 3-155

8. Domain d2dy9a_: 2dy9 A: [131893]
   automated match to d2cwka1
   complexed with adp, cl, mg

Details for d2dy9a_

PDB Entry: 2dy9, 2.01 Å

PDB Description: Crystal structure of nucleoside diphosphate kinase in complex with ADP

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2dy9a_:

Sequence; same for both SEQRES and ATOM records:

>d2dy9a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pyrococcus horikoshii [TaxId: 53953]}
setertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpff
kalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnvih
asdskesaereislffkpeelfeypraadwfykk

Timeline for d2dy9a_:

• d2dy9a_ first appeared in SCOP 1.73, called d2dy9a1
  
• d2dy9a_ appears in SCOPe 2.04
  
• d2dy9a_ appears in SCOPe 2.06
  
• d2dy9a_ appears in the current release, SCOPe 2.08