Lineage for d2dy9a1 (2dy9 A:6-158)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724105Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
  8. 724116Domain d2dy9a1: 2dy9 A:6-158 [131893]
    automatically matched to 2CWK A:6-158
    complexed with adp, cl, mg

Details for d2dy9a1

PDB Entry: 2dy9 (more details), 2.01 Å

PDB Description: Crystal structure of nucleoside diphosphate kinase in complex with ADP
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d2dy9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dy9a1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
sdskesaereislffkpeelfeypraadwfykk

SCOP Domain Coordinates for d2dy9a1:

Click to download the PDB-style file with coordinates for d2dy9a1.
(The format of our PDB-style files is described here.)

Timeline for d2dy9a1: