Lineage for d2dy8a1 (2dy8 A:279-347)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785079Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2785080Protein ATP-dependent helicase CHD1 (Chromo domain protein 1) [141220] (2 species)
  7. 2785081Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141222] (2 PDB entries)
    Uniprot P32657 172-252! Uniprot P32657 249-347
  8. 2785082Domain d2dy8a1: 2dy8 A:279-347 [131892]
    2nd chromodomain

Details for d2dy8a1

PDB Entry: 2dy8 (more details)

PDB Description: solution structure of the second chromodomain of yeast chd1
PDB Compounds: (A:) Chromo domain protein 1

SCOPe Domain Sequences for d2dy8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
defeefhvperiidsqrasledgtsqlqylvkwrrlnydeatwenatdivklapeqvkhf
qnrenskil

SCOPe Domain Coordinates for d2dy8a1:

Click to download the PDB-style file with coordinates for d2dy8a1.
(The format of our PDB-style files is described here.)

Timeline for d2dy8a1: