Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
Protein ATP-dependent helicase CHD1 (Chromo domain protein 1) [141220] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141222] (2 PDB entries) Uniprot P32657 172-252! Uniprot P32657 249-347 |
Domain d2dy8a1: 2dy8 A:279-347 [131892] 2nd chromodomain |
PDB Entry: 2dy8 (more details)
SCOPe Domain Sequences for d2dy8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} defeefhvperiidsqrasledgtsqlqylvkwrrlnydeatwenatdivklapeqvkhf qnrenskil
Timeline for d2dy8a1: