![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
![]() | Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [110101] (8 PDB entries) Uniprot Q53239 |
![]() | Domain d2dy2a2: 2dy2 A:199-372 [131881] automated match to d2bw4a2 complexed with cu |
PDB Entry: 2dy2 (more details), 2.26 Å
SCOPe Domain Sequences for d2dy2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dy2a2 b.6.1.3 (A:199-372) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} gkpvrydtvyyigesdhyipkdedgtymrfsdpsegyedmvavmdtlipshivfngavga ltgegalkakvgdnvlfvhsqpnrdsrphligghgdlvwetgkfhnaperdletwfirgg sagaalykflqpgvyayvnhnlieavhkgatahvlvegewdndlmeqvvapvgl
Timeline for d2dy2a2: