Lineage for d2dy2a2 (2dy2 A:199-372)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367152Family b.6.1.3: Multidomain cupredoxins [49550] (8 protein domains)
  6. 2367387Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2367730Species Rhodobacter sphaeroides [TaxId:1063] [110101] (8 PDB entries)
    Uniprot Q53239
  8. 2367746Domain d2dy2a2: 2dy2 A:199-372 [131881]
    automated match to d2bw4a2
    complexed with cu

Details for d2dy2a2

PDB Entry: 2dy2 (more details), 2.26 Å

PDB Description: Nitrite reductase pH 6.0
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2dy2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dy2a2 b.6.1.3 (A:199-372) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]}
gkpvrydtvyyigesdhyipkdedgtymrfsdpsegyedmvavmdtlipshivfngavga
ltgegalkakvgdnvlfvhsqpnrdsrphligghgdlvwetgkfhnaperdletwfirgg
sagaalykflqpgvyayvnhnlieavhkgatahvlvegewdndlmeqvvapvgl

SCOPe Domain Coordinates for d2dy2a2:

Click to download the PDB-style file with coordinates for d2dy2a2.
(The format of our PDB-style files is described here.)

Timeline for d2dy2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dy2a1